PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_68487.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family SRS
Protein Properties Length: 80aa    MW: 8447.42 Da    PI: 6.227
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_68487.2genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF70284.23.3e-26457101154
        DUF702 101 etsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                    ++++P+evsseavfrcvr++ vd++e+elaYqt+vsigGhvfkGiL+d G+++
  MLOC_68487.2   4 VAERFPREVSSEAVFRCVRLGPVDQAEAELAYQTTVSIGGHVFKGILHDVGPSS 57 
                   5688***********************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051425.2E-23556IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016242.0E-24755IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 80 aa     Download sequence    Send to blast
MVTVAERFPR EVSSEAVFRC VRLGPVDQAE AELAYQTTVS IGGHVFKGIL HDVGPSSNAH  60
AQLQAAAGGS GSDYQFRLTG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2412855e-63AK241285.1 Oryza sativa Japonica Group cDNA, clone: J065137A19, full insert sequence.
GenBankAP0053145e-63AP005314.2 Oryza sativa Japonica Group genomic DNA, chromosome 9, PAC clone:P0515E01.
GenBankAP0055675e-63AP005567.3 Oryza sativa Japonica Group genomic DNA, chromosome 9, BAC clone:OJ1254_E07.
GenBankAP0149655e-63AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankCP0126175e-63CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001130248.19e-34hypothetical protein
RefseqXP_006661471.18e-34PREDICTED: protein SHI RELATED SEQUENCE 1
SwissprotQ9FXH79e-19SRS7_ARATH; Protein SHI RELATED SEQUENCE 7
TrEMBLM0YEK04e-51M0YEK0_HORVD; Uncharacterized protein
TrEMBLM0YEK14e-53M0YEK1_HORVD; Uncharacterized protein
STRINGMLOC_68487.11e-50(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66350.13e-19Lateral root primordium (LRP) protein-related